Basic Information | |
---|---|
Taxon OID | 3300022208 Open in IMG/M |
Scaffold ID | Ga0224495_10189574 Open in IMG/M |
Source Dataset Name | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_4_1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 863 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment → Estuarine Microbial Communities From The San Francisco Bay-Delta (Sfbd), California, United States |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: California | |||||||
Coordinates | Lat. (o) | 38.05 | Long. (o) | -121.934 | Alt. (m) | Depth (m) | 11 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F050345 | Metagenome | 145 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0224495_101895741 | F050345 | AGGAG | MTEHKDKVEARRFQIFKEQTDLPTLELRADWNYMLKRYPSGKIVKVFDDKRKKDEVIY |
⦗Top⦘ |