Scaffold Ga0224495_10002121

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0224495_10002121

Scaffold Ga0224495_10002121

Overview

Basic Information
Taxon OID	3300022208 Open in IMG/M
Scaffold ID	Ga0224495_10002121 Open in IMG/M
Source Dataset Name	Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_4_1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	13270
Total Scaffold Genes	16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	12 (75.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment → Estuarine Microbial Communities From The San Francisco Bay-Delta (Sfbd), California, United States

Source Dataset Sampling Location
Location Name	USA: California
Coordinates	Lat. (^o)	38.05	Long. (^o)	-121.934	Alt. (m)		Depth (m)	11
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F072813	Metagenome / Metatranscriptome	121	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0224495_1000212113	F072813	N/A	MKIENAVVESEAEAQIQKKEPESPPKRSGMKAVLMKKGEYVLSNSLVLPSFDLCLVGERDTVLVPAPNVLPILGVGNKDVKCSKCGYILAMKIKRQQLQNLAIKCPSCDSLNQF

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.