| Basic Information | |
|---|---|
| Taxon OID | 3300022206 Open in IMG/M |
| Scaffold ID | Ga0224499_10041971 Open in IMG/M |
| Source Dataset Name | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_24 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1493 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment → Estuarine Microbial Communities From The San Francisco Bay-Delta (Sfbd), California, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: California | |||||||
| Coordinates | Lat. (o) | 37.7 | Long. (o) | -122.34 | Alt. (m) | Depth (m) | 11 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F041186 | Metagenome / Metatranscriptome | 160 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0224499_100419711 | F041186 | N/A | IATDDDKSINVSEDVYYYENELTDVVYEAIPDYNQIYCDNYDFVEDAITRHYEDLLCRIEDEIIDELLNEGYSHKVVNPINTLQYIEMISQDDQFNKDLPKLYIGAINLTVDEDYRYLNYASQIIKDRARYEIVANHYGLTIERAVKGELIFKELKNEN |
| ⦗Top⦘ |