Basic Information | |
---|---|
Taxon OID | 3300022205 Open in IMG/M |
Scaffold ID | Ga0224511_10232457 Open in IMG/M |
Source Dataset Name | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_8_1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1698 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment → Estuarine Microbial Communities From The San Francisco Bay-Delta (Sfbd), California, United States |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: California | |||||||
Coordinates | Lat. (o) | 38.03 | Long. (o) | -122.15 | Alt. (m) | Depth (m) | 14 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F003537 | Metagenome / Metatranscriptome | 480 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0224511_102324571 | F003537 | AGG | VIKVKVTVTKIEIQFPLNNFSLLWPIDTKLAVWVAYIKRQIGIVTQVSVIKVKVTVTKNRNSVSAQ |
⦗Top⦘ |