Scaffold Ga0228535_1007299

Overview

Basic Information

• Taxon OID: 3300022181
• Scaffold ID: Ga0228535_1007299
• Source Dataset Name: Enriched culture of PCE-dechlorinating microbial communities from Ithaca, New York, USA - SJ1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 4759
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Modeled → Simulated Communities (Microbial Mixture) → Unclassified → Unclassified → Defined Medium → Enriched Cultures Of Pce-Dechlorinating Microbial Communities From Ithaca, New York, Usa

Source Dataset Sampling Location

• Location Name: USA: New York
• Coordinates
  • Lat. (^o): 42.4447
  • Long. (^o): -76.485

Associated Families

Family	Category	Number of Sequences	3D Structure?
F073159	Metagenome / Metatranscriptome	120	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0228535_10072996	F073159	N/A	RRKKHAVRPGAGVMCNVCGVNCGKGGALKKHVEGAHKVDYKQYKTCFSGCVKTLIADSWDDSVKTSTGKIVITHVLVRRFIGDPSKRGVSWKNP