Scaffold Ga0228535_1006786

Overview

Basic Information

• Taxon OID: 3300022181
• Scaffold ID: Ga0228535_1006786
• Source Dataset Name: Enriched culture of PCE-dechlorinating microbial communities from Ithaca, New York, USA - SJ1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 5161
• Total Scaffold Genes: 12
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 11 (91.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Modeled → Simulated Communities (Microbial Mixture) → Unclassified → Unclassified → Defined Medium → Enriched Cultures Of Pce-Dechlorinating Microbial Communities From Ithaca, New York, Usa

Source Dataset Sampling Location

• Location Name: USA: New York
• Coordinates
  • Lat. (^o): 42.4447
  • Long. (^o): -76.485

Associated Families

Family	Category	Number of Sequences	3D Structure?
F059711	Metagenome	133	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0228535_10067863	F059711	AGGAG	MRNRTFHTSINLLIEPDTYQRLKMIAGLQKTTMSKFIREGIKLRLAQHDKENNSIVEG