Scaffold Ga0181353_1002146

Overview

Basic Information

• Taxon OID: 3300022179
• Scaffold ID: Ga0181353_1002146
• Source Dataset Name: Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 4224
• Total Scaffold Genes: 15
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (13.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location

• Location Name: USA: Michigan
• Coordinates
  • Lat. (^o): 43.2382
  • Long. (^o): -86.2805
  • Depth (m): 8

Associated Families

Family	Category	Number of Sequences	3D Structure?
F073275	Metagenome / Metatranscriptome	120	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0181353_10021464	F073275	N/A	MIKYLKVDLNNCYGISLCDTKDEVFESCGYDVDEITFEELCKRLSGEYEIVEITGDFKLNWVCE