| Basic Information | |
|---|---|
| Taxon OID | 3300022177 Open in IMG/M |
| Scaffold ID | Ga0228536_1000493 Open in IMG/M |
| Source Dataset Name | Enriched culture of PCE-dechlorinating microbial communities from Ithaca, New York, USA - SJ1.S |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 70810 |
| Total Scaffold Genes | 77 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 72 (93.51%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Engineered → Modeled → Simulated Communities (Microbial Mixture) → Unclassified → Unclassified → Defined Medium → Enriched Cultures Of Pce-Dechlorinating Microbial Communities From Ithaca, New York, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: New York | |||||||
| Coordinates | Lat. (o) | 42.4447 | Long. (o) | -76.485 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F018395 | Metagenome / Metatranscriptome | 235 | Y |
| F020198 | Metagenome | 225 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0228536_100049320 | F018395 | GGAGG | MSSGLKLDRADTAYAEKAHELSLKNRNWLRHGIGTTADKIDEMLLDGATIEQMAKKAKTTKATVSVHLTHLRKVHKLAIARKDGVLMYDVDGMKEKQRVRGRKTK |
| Ga0228536_100049321 | F020198 | AGGAG | MLVIPHKKLKSREATMEFLLDPARLKTFVLDLRAYLKSTQHQFHKVGFENDPKHCVHRGMYDRPETVLFRRFNHFCYEQGLDWEGAREMVELMLNERFLCECEILWRLKDEQVEERLSSR |
| ⦗Top⦘ |