Scaffold Ga0213931_1050372

Overview

Basic Information

• Taxon OID: 3300022161
• Scaffold ID: Ga0213931_1050372
• Source Dataset Name: Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 3-17 MT (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 512
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater → Freshwater Microbial Communities From Mcnutts Creek, Athens, Georgia, United States

Source Dataset Sampling Location

• Location Name: USA: Georgia
• Coordinates
  • Lat. (^o): 33.9301
  • Long. (^o): -83.5517
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033016	Metagenome / Metatranscriptome	178	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0213931_10503721	F033016	GGAG	MEAAERWQPLRASKKPLRATGSEEEAASGEPGRIDPWVDEISPRGAERRNVR