NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0196889_1008415

Scaffold Ga0196889_1008415


Overview

Basic Information
Taxon OID3300022072 Open in IMG/M
Scaffold IDGa0196889_1008415 Open in IMG/M
Source Dataset NameAqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2307
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous → Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series

Source Dataset Sampling Location
Location NameUSA: Delaware Bay
CoordinatesLat. (o)39.12Long. (o)-75.25Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F054676Metagenome / Metatranscriptome139N
F081060Metagenome / Metatranscriptome114N

Sequences

Protein IDFamilyRBSSequence
Ga0196889_10084152F081060N/AMQNKLYANLDKYWQTVVDDLVQSLKDVGRYASGNTAQAIGDGNAQPVAITANGFKITIAMPDYYEYLDEGVSGAKNNTGISRFKYTNKMPPIKAIRKFMLNRGINAPRSSNTKSGKRQDAEKIRNGIAFAIARSIFNNGTKRTDFYSNVINDKKLIAFEQMLLAQYSNYVIELIKIV
Ga0196889_10084153F054676AGGMAITIQDQPTTTYVLPAFAPIEYLLSSTNTAQPGFKIVCKVYLNPSGANTLISTQQISVRPLTTQAILSIQDVVKSFVPINYSVPEGDTVGLISDTLNEFKVTFQEYYDSALQGSVVASNIISSYAASPKYIQFASNEWQDYQLATSAIEKNLLSNFSNTIPVINAFSGANNWLKVKTDQKTQIQWLQSGASANFRVWLKTLDASFNQISLSQLDLTTTAKGYFALDIGRQEASAHAWDTPIVWTNAKYYAVAIYDESTTELVSNAYLYELDDCNTNYTPFELHWLNRWGGFDSFVFDGKSNQTTEVNKTFAKYSPDRISGTSLNYSTSAQRTRAFNTATSESYNLNSRLLQDFEVSGLEDLVTSPEVYWRSEAGFVSVNVSGRTYQHAKSENGLVYSLALDMVIDNSDERQW
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.