Scaffold Ga0226661_10729927

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0226661_10729927

Scaffold Ga0226661_10729927

Overview

Basic Information
Taxon OID	3300021982 Open in IMG/M
Scaffold ID	Ga0226661_10729927 Open in IMG/M
Source Dataset Name	Food waste microbial community from Durham, Ontario, Canada - FW1 spades
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Toronto
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	554
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Aerobic → Unclassified → Unclassified → Food Waste → Metagenomes From Anaerobic Digester Of Solid Waste

Source Dataset Sampling Location
Location Name	Durham, Ontario, Canada
Coordinates	Lat. (^o)	44.1763	Long. (^o)	-80.8185	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F057039	Metagenome / Metatranscriptome	136	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0226661_107299271	F057039	N/A	HCKWAEILHGVGLEMVVQWGWIYEMDVVEAVVVVEVDGRDSMESGMEDIEGNIEDVEDFPNKDLANHVAKIGFGVEMAKVAKEGVCPN

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.