Basic Information | |
---|---|
Taxon OID | 3300021979 Open in IMG/M |
Scaffold ID | Ga0232641_1430768 Open in IMG/M |
Source Dataset Name | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Hafa_FS926 _150kmer |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Marine Biological Laboratory |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 503 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids → Characterization Of Microbial Community From Mariana Back Arc |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Hafa Adai vent field, Mariana back arc basin | |||||||
Coordinates | Lat. (o) | 16.96131294 | Long. (o) | 144.8678188 | Alt. (m) | Depth (m) | 3277 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F099409 | Metagenome | 103 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0232641_14307681 | F099409 | N/A | TGNTWYEDEEPSPEGWNIMALGRIWEWASRPTIIDRARAEGLEFTPQVVREVDGIVGSLDGVLSSPLAPDHIVAVVEAKSRHSSPSDPRDNWRYMVQSMAYLYMTGCTSLWMPILYLPRRGPPDSPFHLYRIEFEPHQLVENWVMLRNVRDA |
⦗Top⦘ |