Scaffold Ga0232641_1381471

Overview

Basic Information

• Taxon OID: 3300021979
• Scaffold ID: Ga0232641_1381471
• Source Dataset Name: Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Hafa_FS926 _150kmer
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Marine Biological Laboratory
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 536
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Arcobacteraceae → Arcobacter → unclassified Arcobacter → Arcobacter sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids → Characterization Of Microbial Community From Mariana Back Arc

Source Dataset Sampling Location

• Location Name: Hafa Adai vent field, Mariana back arc basin
• Coordinates
  • Lat. (^o): 16.96131294
  • Long. (^o): 144.8678188
  • Depth (m): 3277

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007267	Metagenome / Metatranscriptome	354	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0232641_13814711	F007267	N/A	ECKFRKFESLNALNVHIGKSHIVNYRISIINNKVVFKTKTRGTFQYIEKT