NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0232641_1052350

Scaffold Ga0232641_1052350


Overview

Basic Information
Taxon OID3300021979 Open in IMG/M
Scaffold IDGa0232641_1052350 Open in IMG/M
Source Dataset NameHydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Hafa_FS926 _150kmer
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMarine Biological Laboratory
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1552
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids → Characterization Of Microbial Community From Mariana Back Arc

Source Dataset Sampling Location
Location NameHafa Adai vent field, Mariana back arc basin
CoordinatesLat. (o)16.96131294Long. (o)144.8678188Alt. (m)Depth (m)3277
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F016055Metagenome / Metatranscriptome250Y

Sequences

Protein IDFamilyRBSSequence
Ga0232641_10523504F016055AGGMEEEFHIEKHGSLRKLKRLVNKRERLQIKNYLKGNSPEDFIDYDDDIEYDNNREKR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.