Scaffold Ga0232646_1311827

Overview

Basic Information

• Taxon OID: 3300021978
• Scaffold ID: Ga0232646_1311827
• Source Dataset Name: Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Perseverance_CTD_V16A_01_btl17 _150kmer
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Marine Biological Laboratory
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 539
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Marine Group I → Marine Group I thaumarchaeote (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Fluids → Characterization Of Microbial Community From Mariana Back Arc

Source Dataset Sampling Location

• Location Name: Perseverance vent field water column
• Coordinates
  • Lat. (^o): 15.47990499
  • Long. (^o): 144.50763029
  • Depth (m): 3625

Associated Families

Family	Category	Number of Sequences	3D Structure?
F009367	Metagenome / Metatranscriptome	319	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0232646_13118273	F009367	GGAG	MKEVHSQLVDVVLLTQENGSTMLCRGGEDAVRRFWEIWPIVKAEFTGEKQLL