| Basic Information | |
|---|---|
| Taxon OID | 3300021978 Open in IMG/M |
| Scaffold ID | Ga0232646_1118998 Open in IMG/M |
| Source Dataset Name | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Perseverance_CTD_V16A_01_btl17 _150kmer |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Marine Biological Laboratory |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 890 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Fluids → Characterization Of Microbial Community From Mariana Back Arc |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Perseverance vent field water column | |||||||
| Coordinates | Lat. (o) | 15.47990499 | Long. (o) | 144.50763029 | Alt. (m) | Depth (m) | 3625 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001721 | Metagenome / Metatranscriptome | 647 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0232646_11189983 | F001721 | GAGG | MNRNSIWSNERKEIATWLSGYLAMVKKWVDKILDNEDHDVDKNKIIKLIDEWIGWLEETKAKIMMMRDVDPEEIKEEE |
| ⦗Top⦘ |