Basic Information | |
---|---|
Taxon OID | 3300021978 Open in IMG/M |
Scaffold ID | Ga0232646_1105159 Open in IMG/M |
Source Dataset Name | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Perseverance_CTD_V16A_01_btl17 _150kmer |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Marine Biological Laboratory |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 951 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Fluids → Characterization Of Microbial Community From Mariana Back Arc |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Perseverance vent field water column | |||||||
Coordinates | Lat. (o) | 15.47990499 | Long. (o) | 144.50763029 | Alt. (m) | Depth (m) | 3625 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F092724 | Metagenome | 107 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0232646_11051592 | F092724 | GGAG | VILELLLPLFIILYWFTEGVTEGYTWAKLKRRKENKLIHPNHGTNGIMDYHGWRIFENIGIWGTVVTAYFMTPCCTVPVKSFFLLGIGAWLIGTFCYEAALNHIYYGKIWKPVDYRWHIFGRDIPWFGGKKSLVLVGLGLLIISLGILEK |
⦗Top⦘ |