| Basic Information | |
|---|---|
| Taxon OID | 3300021977 Open in IMG/M |
| Scaffold ID | Ga0232639_1163647 Open in IMG/M |
| Source Dataset Name | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Hafa_FS925 _150kmer |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Marine Biological Laboratory |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 848 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Thaumasvirus → unclassified Thaumasvirus → Prochlorococcus phage P-RSM4 | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids → Characterization Of Microbial Community From Mariana Back Arc |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Hafa Adai vent field, Mariana back arc basin | |||||||
| Coordinates | Lat. (o) | 16.96173128 | Long. (o) | 144.86920936 | Alt. (m) | Depth (m) | 3278 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F097514 | Metagenome | 104 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0232639_11636473 | F097514 | N/A | MKSLLFKIGVGVSVTLNLFVFTVAMYGLITREERVEENRKWLKETIEKEVYDQIKFVMPK |
| ⦗Top⦘ |