Scaffold Ga0232635_1053971

Overview

Basic Information

• Taxon OID: 3300021973
• Scaffold ID: Ga0232635_1053971
• Source Dataset Name: Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Alice_FS923 _150kmer
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Marine Biological Laboratory
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 909
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids → Characterization Of Microbial Community From Mariana Back Arc

Source Dataset Sampling Location

• Location Name: Alice Springs vent field, Mariana back arc basin
• Coordinates
  • Lat. (^o): 18.210325
  • Long. (^o): 144.707309
  • Depth (m): 3610

Associated Families

Family	Category	Number of Sequences	3D Structure?
F016673	Metagenome	245	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0232635_10539711	F016673	N/A	TEDIVIKSYVELYLKALNESRSYKFIKIIKSRMFELIKRKQIRNQTK