Scaffold Ga0227318_10579248

Overview

Basic Information

• Taxon OID: 3300021971
• Scaffold ID: Ga0227318_10579248
• Source Dataset Name: Food waste and fibre mixture microbial community, University of Toronto, Ontario, Canada - LBfeed2 spades
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Toronto
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 506
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Food Waste → Metagenomes From Anaerobic Digester Of Solid Waste

Source Dataset Sampling Location

• Location Name: University of Toronto, Toronto, Ontario, Canada
• Coordinates
  • Lat. (^o): 43.6629
  • Long. (^o): -79.3957

Associated Families

Family	Category	Number of Sequences	3D Structure?
F067310	Metagenome / Metatranscriptome	125	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0227318_105792481	F067310	N/A	VQEWKKSSARCGADVALSLVRVHCKEVRQDKLAAIKVANTQKHDFRTFMETFIAAATRIADGVDLDEFVEPASPPPAE