NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0232063_1150340

Scaffold Ga0232063_1150340


Overview

Basic Information
Taxon OID3300021969 Open in IMG/M
Scaffold IDGa0232063_1150340 Open in IMG/M
Source Dataset NameMetatranscriptome of anaerobic ammonium oxidizing microbial communities from anammox membrane bioreactor (MBR) in UC Berkley, California, United States - LAC_MetaT_7 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)811
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Bioreactor Biomass → Anaerobic Ammonium Oxidizing Microbial Communities From Anammox Membrane Bioreactor (Mbr) In Uc Berkley, California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)37.8719Long. (o)-122.2585Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000344Metagenome / Metatranscriptome1257Y

Sequences

Protein IDFamilyRBSSequence
Ga0232063_11503402F000344GGAMRPRSAPAALSGVGEHTARESESAQCCAAGKERVANAH

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.