Scaffold Ga0213848_1043180

Overview

Basic Information

• Taxon OID: 3300021967
• Scaffold ID: Ga0213848_1043180
• Source Dataset Name: Metatranscriptome of freshwater microbial communities from post-fracked creek in Pennsylvania, United States - AB:C (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2485
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 6 (85.71%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds → Freshwater And Sediment Microbial Communities From Various Areas In North America, Analyzing Microbe Dynamics In Response To Fracking

Source Dataset Sampling Location

• Location Name: USA: Pennsylvania
• Coordinates
  • Lat. (^o): 41.1752
  • Long. (^o): -78.4168

Associated Families

Family	Category	Number of Sequences	3D Structure?
F017628	Metagenome / Metatranscriptome	239	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0213848_10431801	F017628	AGGA	MATYDIEALKEDLPTAKDLAQFVYDKTGIALDLVGKTKTDQYIVAKQALEGKKVPSDFLTDKNPYIDSKELIPEDELAELPPRNPDLPPVESQIHFFGATNMPHPTDPQSDRKVMIDFRKYENGAITFQIVAPGEKVAVGSRINRYGQTVPEKYTWIDPRTPETLLRRPE