Scaffold Ga0226662_10396520

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0226662_10396520

Scaffold Ga0226662_10396520

Overview

Basic Information
Taxon OID	3300021966 Open in IMG/M
Scaffold ID	Ga0226662_10396520 Open in IMG/M
Source Dataset Name	Food waste microbial community from Durham, Ontario, Canada - FW2 spades
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Toronto
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	527
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Food Waste → Metagenomes From Anaerobic Digester Of Solid Waste

Source Dataset Sampling Location
Location Name	Durham, Ontario, Canada
Coordinates	Lat. (^o)	43.6629	Long. (^o)	-79.3957	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F004001	Metagenome	457	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0226662_103965201	F004001	N/A	VVVQSLSLEVFKECGGVALRDVVSGHGGDGVMVGLYDLSCLFQP

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.