NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0226662_10278673

Scaffold Ga0226662_10278673


Overview

Basic Information
Taxon OID3300021966 Open in IMG/M
Scaffold IDGa0226662_10278673 Open in IMG/M
Source Dataset NameFood waste microbial community from Durham, Ontario, Canada - FW2 spades
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Toronto
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)618
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Food Waste → Metagenomes From Anaerobic Digester Of Solid Waste

Source Dataset Sampling Location
Location NameDurham, Ontario, Canada
CoordinatesLat. (o)43.6629Long. (o)-79.3957Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F014592Metagenome / Metatranscriptome261Y
F032187Metagenome / Metatranscriptome180Y

Sequences

Protein IDFamilyRBSSequence
Ga0226662_102786731F014592N/ADPEGPIGWISHEAEAFEEVLNSRGDICAFSGARGIATILESRGCDHVKSLAQAEAALSSEDIKDPSAEASLVGGKFFTDIWENGGREMAQEIIRKSEKGIHDARKVAEAAEKSADLERRIGIDY
Ga0226662_102786732F032187N/AMTSDLFTLCNTAVQAPPPEPADPLAEPKAKGDDEIRKMAKAIMDKVVDQLLNEAAEVVLRED

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.