Scaffold Ga0227319_10431816

Overview

Basic Information

• Taxon OID: 3300021965
• Scaffold ID: Ga0227319_10431816
• Source Dataset Name: Food waste and fibre mixture microbial community, University of Toronto, Ontario, Canada - LBfeed1 spades
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Toronto
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 815
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Bioreactor → Aerobic → Unclassified → Unclassified → Food Waste → Metagenomes From Anaerobic Digester Of Solid Waste

Source Dataset Sampling Location

• Location Name: University of Toronto, Toronto, Ontario, Canada
• Coordinates
  • Lat. (^o): 43.6629
  • Long. (^o): -79.3957

Associated Families

Family	Category	Number of Sequences	3D Structure?
F038012	Metagenome	166	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0227319_104318161	F038012	AGGA	MIIEFQPPCYMQGRQPLDQAAQSLIQPGLECLQGWGIH