NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0222712_10034801

Scaffold Ga0222712_10034801


Overview

Basic Information
Taxon OID3300021963 Open in IMG/M
Scaffold IDGa0222712_10034801 Open in IMG/M
Source Dataset NameEstuarine water microbial communities from San Francisco Bay, California, United States - C33_657D
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3931
Total Scaffold Genes14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)13 (92.86%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water → Estuarine Microbial Communities From The San Francisco Bay-Delta (Sfbd), California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)38.1516Long. (o)-121.6883Alt. (m)Depth (m)10
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002009Metagenome / Metatranscriptome604Y
F011753Metagenome / Metatranscriptome287Y
F039993Metagenome / Metatranscriptome162Y

Sequences

Protein IDFamilyRBSSequence
Ga0222712_1003480110F039993AGGAMRLTLAWICYWIGHAISETILRLGYGYSLYNKLMILSVDLDDNGVIWK
Ga0222712_1003480113F002009GGAMKPPTIEELGKAAEDITWRVMGKGSEKSAYGEWFMVDKPVHDYHIGRAMRHLSTAMLQLQKSTPCPDNNGETAADHLERALVRALFAWAQVKREVPRL
Ga0222712_1003480114F011753N/AEWAEDNIERTYWCEKALVGAGYAGRCDAYVKLRGIGDAIIDLKNRKVNPKYDPFYDSDCAQLWAYRIASGNPKAACVSVVLAANDPETLVIHQWSEDELHEAGIAFSAMLKVWAWSKKYNPPGMKL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.