NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0222712_10022707

Scaffold Ga0222712_10022707


Overview

Basic Information
Taxon OID3300021963 Open in IMG/M
Scaffold IDGa0222712_10022707 Open in IMG/M
Source Dataset NameEstuarine water microbial communities from San Francisco Bay, California, United States - C33_657D
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5163
Total Scaffold Genes18 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (55.56%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water → Estuarine Microbial Communities From The San Francisco Bay-Delta (Sfbd), California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)38.1516Long. (o)-121.6883Alt. (m)Depth (m)10
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F028171Metagenome / Metatranscriptome192Y
F050371Metagenome / Metatranscriptome145N
F077290Metagenome / Metatranscriptome117N

Sequences

Protein IDFamilyRBSSequence
Ga0222712_1002270710F028171GGAGGMGDDIRGKLEALITDSSMFHAGQQDERLRLCRLIDIRLEDLRNLVRQPTISARLEELLHIRQALRDHS
Ga0222712_100227073F050371GAGMTFKIKGAIFKNTAEKLQQRLGDRYDASKKYPDVDGVFGIKEEDRMAFASYIMNAAVNDKGEVPLRVNGYNNTSQSSGVKYLGLTIEPDFKTLKAIEEALLAAVPPAAAALVPEVVNVAQDDLF
Ga0222712_100227074F077290AGGAMQCPKCSHSRHGVRSSNSQLPDQVVRQRVCQACGWMWFTVEAEVNRFAIGWSTASSKPVLREAVTLELGFVPQLPPGRPPRVHITNRDIRGDAPPVVGIIRGRPKGLPSTSQK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.