Scaffold Ga0222714_10280076

Overview

Basic Information

• Taxon OID: 3300021961
• Scaffold ID: Ga0222714_10280076
• Source Dataset Name: Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 923
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water → Estuarine Microbial Communities From The San Francisco Bay-Delta (Sfbd), California, United States

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 38.0516
  • Long. (^o): -121.88
  • Depth (m): 13

Associated Families

Family	Category	Number of Sequences	3D Structure?
F020539	Metagenome / Metatranscriptome	223	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0222714_102800762	F020539	N/A	MARTQNEELISLKGHITGIKRELKILGCSVYKLEKKLETLFWSILCGLGALSLALITIFLAK