Scaffold Ga0222715_10265967

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0222715_10265967

Scaffold Ga0222715_10265967

Overview

Basic Information
Taxon OID	3300021960 Open in IMG/M
Scaffold ID	Ga0222715_10265967 Open in IMG/M
Source Dataset Name	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	990
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water → Estuarine Microbial Communities From The San Francisco Bay-Delta (Sfbd), California, United States

Source Dataset Sampling Location
Location Name	USA: California
Coordinates	Lat. (^o)	38.0566	Long. (^o)	-122.185	Alt. (m)		Depth (m)	29
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007226	Metagenome / Metatranscriptome	355	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0222715_102659672	F007226	GAGG	MQKLLNRITHYFLNRAYAQLEAAGDLQNADDVAEFLEDYYAQKVI

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.