Scaffold Ga0222715_10041982

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0222715_10041982

Scaffold Ga0222715_10041982

Overview

Basic Information
Taxon OID	3300021960 Open in IMG/M
Scaffold ID	Ga0222715_10041982 Open in IMG/M
Source Dataset Name	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	3212
Total Scaffold Genes	10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	6 (60.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water → Estuarine Microbial Communities From The San Francisco Bay-Delta (Sfbd), California, United States

Source Dataset Sampling Location
Location Name	USA: California
Coordinates	Lat. (^o)	38.0566	Long. (^o)	-122.185	Alt. (m)		Depth (m)	29
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F029733	Metagenome / Metatranscriptome	187	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0222715_100419828	F029733	N/A	MTRKNGGVEETCQHMEYVKMQTRRMAIDGEWFTVQFFKEGDGSIRVEVVHDIKNKYYKMYPDNKITFEESKDE

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.