| Basic Information | |
|---|---|
| Taxon OID | 3300021960 Open in IMG/M |
| Scaffold ID | Ga0222715_10021604 Open in IMG/M |
| Source Dataset Name | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4799 |
| Total Scaffold Genes | 8 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 7 (87.50%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water → Estuarine Microbial Communities From The San Francisco Bay-Delta (Sfbd), California, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: California | |||||||
| Coordinates | Lat. (o) | 38.0566 | Long. (o) | -122.185 | Alt. (m) | Depth (m) | 29 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F086793 | Metagenome / Metatranscriptome | 110 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0222715_100216047 | F086793 | AGGAG | MEKTLEILLEQIRLKRQQIVEAVSTNAAKDYAEYQKLCGEIRGLSMAEGFILDLAKQMEFSDD |
| ⦗Top⦘ |