Basic Information | |
---|---|
Taxon OID | 3300021959 Open in IMG/M |
Scaffold ID | Ga0222716_10077518 Open in IMG/M |
Source Dataset Name | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2290 |
Total Scaffold Genes | 8 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 7 (87.50%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water → Estuarine Microbial Communities From The San Francisco Bay-Delta (Sfbd), California, United States |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: California | |||||||
Coordinates | Lat. (o) | 38.0283 | Long. (o) | -122.37 | Alt. (m) | Depth (m) | 10 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F038426 | Metagenome / Metatranscriptome | 166 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0222716_100775188 | F038426 | N/A | MKIDINWDTVEAIGIEYVKESYVGLLETFSGYDPENADHKEDFYNNEWRVECFQTVLKYILPEGESHEFIAGQRQKHLSQIDLFN |
⦗Top⦘ |