Scaffold Ga0222718_10466510

Overview

Basic Information

• Taxon OID: 3300021958
• Scaffold ID: Ga0222718_10466510
• Source Dataset Name: Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 617
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water → Estuarine Microbial Communities From The San Francisco Bay-Delta (Sfbd), California, United States

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 37.6183
  • Long. (^o): -122.2916
  • Depth (m): 12

Associated Families

Family	Category	Number of Sequences	3D Structure?
F044935	Metagenome / Metatranscriptome	153	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0222718_104665102	F044935	N/A	MNKVLDEVSKSNNEFNEVRDPKKLCVHDLKQKLKIKQKKQLIKNIIILSVIIILFGAISILVYQNL