NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0222718_10117013

Scaffold Ga0222718_10117013


Overview

Basic Information
Taxon OID3300021958 Open in IMG/M
Scaffold IDGa0222718_10117013 Open in IMG/M
Source Dataset NameEstuarine water microbial communities from San Francisco Bay, California, United States - C33_27D
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1547
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (87.50%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water → Estuarine Microbial Communities From The San Francisco Bay-Delta (Sfbd), California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)37.6183Long. (o)-122.2916Alt. (m)Depth (m)12
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004343Metagenome / Metatranscriptome442Y
F008887Metagenome / Metatranscriptome326Y
F058110Metagenome / Metatranscriptome135N

Sequences

Protein IDFamilyRBSSequence
Ga0222718_101170132F058110AGGAGMDEYNNVAISRITFFKFDDEGNELENEDGTTKEFKLKSVRFKPLEYLCEDLDADYLEPIEGQS
Ga0222718_101170135F004343GAGGMTQYKEMIDEARQLLNTERENIPSMSRNFQKDYWILTYPCGKIVKTYQDKRKRDIVIQESFNGGEL
Ga0222718_101170136F008887GGGGGMSRGCCNECGYKADYIIDNNNYADNGYKDLNQVPTDKMLCGVCYEENENE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.