Scaffold Ga0222717_10542925

Overview

Basic Information

• Taxon OID: 3300021957
• Scaffold ID: Ga0222717_10542925
• Source Dataset Name: Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 619
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Puniceispirillum phage HMO-2011 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water → Estuarine Microbial Communities From The San Francisco Bay-Delta (Sfbd), California, United States

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 37.0966
  • Long. (^o): -122.4216
  • Depth (m): 38

Associated Families

Family	Category	Number of Sequences	3D Structure?
F037204	Metagenome	168	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0222717_105429251	F037204	GGAG	MNIEIYKKLSMYDFAMDMYQKAMHMKHDHNVEHYDVQEIINYLQFIHDLEK