| Basic Information | |
|---|---|
| Taxon OID | 3300021957 Open in IMG/M |
| Scaffold ID | Ga0222717_10318828 Open in IMG/M |
| Source Dataset Name | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 882 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water → Estuarine Microbial Communities From The San Francisco Bay-Delta (Sfbd), California, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: California | |||||||
| Coordinates | Lat. (o) | 37.0966 | Long. (o) | -122.4216 | Alt. (m) | Depth (m) | 38 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F028616 | Metagenome / Metatranscriptome | 191 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0222717_103188281 | F028616 | AGGAG | MPILSKAQNDLLMSLVKRRSYSVHHKYHSPSRIAFTTYAEAKAYCVKHNLNYKSSWVLTTVCHMA |
| ⦗Top⦘ |