NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0213922_1055482

Scaffold Ga0213922_1055482


Overview

Basic Information
Taxon OID3300021956 Open in IMG/M
Scaffold IDGa0213922_1055482 Open in IMG/M
Source Dataset NameFreshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)869
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater → Freshwater Microbial Communities From Mcnutts Creek, Athens, Georgia, United States

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)33.9263Long. (o)-83.4268Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008995Metagenome / Metatranscriptome324Y
F012339Metagenome / Metatranscriptome281Y

Sequences

Protein IDFamilyRBSSequence
Ga0213922_10554821F008995AGGAMAAVQVVNATGNVAWTTDKVAISTGAANVTFQVSLTQTQWIQANGVPANTAMPTGNLYANAIVVPANSSEQYYVGVGNYLNILTGSGFSA
Ga0213922_10554822F012339AGGAMTTNQPFTAGLTTPPVINPHSPATGGYKQQPVYIPGVLDQTRNLYQPVVSEVPKDNK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.