Scaffold Ga0213922_1006490

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0213922_1006490

Scaffold Ga0213922_1006490

Overview

Basic Information
Taxon OID	3300021956 Open in IMG/M
Scaffold ID	Ga0213922_1006490 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	3472
Total Scaffold Genes	12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	10 (83.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater → Freshwater Microbial Communities From Mcnutts Creek, Athens, Georgia, United States

Source Dataset Sampling Location
Location Name	USA: Georgia
Coordinates	Lat. (^o)	33.9263	Long. (^o)	-83.4268	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F079997	Metagenome	115	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0213922_100649011	F079997	AGGA	MMPSIDMGSTYESHKFKLCARCDTQKPPEGGIELGVKWNCQSCWLKRITGVHLKQNRIDGGK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.