| Basic Information | |
|---|---|
| Taxon OID | 3300021953 Open in IMG/M |
| Scaffold ID | Ga0213880_10147804 Open in IMG/M |
| Source Dataset Name | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R07 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 640 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock → Plant-Associated Microbial Communities From Velloziaceae Species In Rupestrian Grasslands, The National Park Of Serra Do Cipo, Brazil |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Brazil: Minas Gerais | |||||||
| Coordinates | Lat. (o) | -19.28 | Long. (o) | -43.5919 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F044126 | Metagenome / Metatranscriptome | 155 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0213880_101478041 | F044126 | N/A | KEAFGIIQAVDAKLAESLRAVWEQTAKARQANLCCYLAKYPYKHFVFKNGRALDPDGQPLRPDLLVAGQLPVGLILDNLLEVIDEVIRNEEVIEFPQSLLFKDNLIGLWELIDQQLKVEGHPSPNWTISSGSRSLKFIEFPTQKVQWDRLRTRYRQLSTYDKEVVRKLREIDLIRMIGEIDQKSKQWSTQILYFSSLWFDELEQQLADRARVV |
| ⦗Top⦘ |