NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0213921_1005305

Scaffold Ga0213921_1005305


Overview

Basic Information
Taxon OID3300021952 Open in IMG/M
Scaffold IDGa0213921_1005305 Open in IMG/M
Source Dataset NameFreshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17 MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2624
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater → Freshwater Microbial Communities From Mcnutts Creek, Athens, Georgia, United States

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)33.9266Long. (o)-83.4611Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008402Metagenome / Metatranscriptome334Y
F013514Metagenome / Metatranscriptome270Y
F057309Metagenome / Metatranscriptome136Y

Sequences

Protein IDFamilyRBSSequence
Ga0213921_100530510F057309AGGAMNPLLQKYEELYGKKEPPKMPRIEDYEGEETFADELKKSKPPILKSYDLDDLKASFQQVAEQLQNDKAQVVSMNMEFGDHMNKITFEVYVYKP
Ga0213921_10053057F008402N/AMTIEITNQVRIQEHTDYWYTVEDTHLDVGFEGCTISYWELPSGVNTSEKRVNHICMEKEEALAVADAIYKFFKKD
Ga0213921_10053059F013514GAGGMSTNLEELQKYLDDNNITFEEYMRANMITDEERKYIDKVWMNAIYKNLGEDT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.