Scaffold Ga0063102_1039113

Overview

Basic Information

• Taxon OID: 3300021941
• Scaffold ID: Ga0063102_1039113
• Source Dataset Name: Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-120M (Eukaryote Community Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 603
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean

Source Dataset Sampling Location

• Location Name: Arctic Ocean
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F009426	Metagenome / Metatranscriptome	318	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0063102_10391131	F009426	N/A	VKLKNANFSTATKVNKNVKLLLNMTFSEILYTIIFFMTTSPCVISAGAARETLFEGKADYCMIVCE