Scaffold Ga0063754_1039888

Overview

Basic Information

• Taxon OID: 3300021937
• Scaffold ID: Ga0063754_1039888
• Source Dataset Name: Marine eukaryotic phytoplankton communities from the South Atlantic Ocean - 30m ANT-15 Euk ARK-20-2 (Eukaryote Community Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 795
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean

Source Dataset Sampling Location

• Location Name: South Atlantic Ocean
• Coordinates
  • Lat. (^o): 78.8697
  • Long. (^o): 8.1122

Associated Families

Family	Category	Number of Sequences	3D Structure?
F083648	Metatranscriptome	112	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0063754_10398881	F083648	N/A	PSDEQAHEDELKYSTVTGPASGDPKIMGLYGKRFQIHRPGDHALLIVPNAKKRHGSLLEVSAQVKELEIGDPCLLFIKKVTLTGSWLGGTTVQVRAQGTTGSDFALKVDPKKHNSPWKPFKNMTGWEQFIHKDEGSGIVTTVKGVIGRREGHSEDIKGPSEHRFLFRVGKEDQKAKKLEIDVAMPKPGRQYVTVKVTHVKGLGEAVSQSLGGLLGLDSKAVTKSYETHKKSLEVRDECKDSATGTKASELLALSGGLSRAIAHW