Scaffold Ga0213845_1068836

Overview

Basic Information

• Taxon OID: 3300021929
• Scaffold ID: Ga0213845_1068836
• Source Dataset Name: Metatranscriptome of freshwater microbial communities from pre-fracked creek in Pennsylvania, United States - DR:C (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 540
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Riboviria → Orthornavirae → Lenarviricota → Miaviricetes → Ourlivirales → Botourmiaviridae → unclassified Botourmiaviridae → Botourmiaviridae sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds → Freshwater And Sediment Microbial Communities From Various Areas In North America, Analyzing Microbe Dynamics In Response To Fracking

Source Dataset Sampling Location

• Location Name: USA: Pennsylvania
• Coordinates
  • Lat. (^o): 41.1553
  • Long. (^o): -78.3938

Associated Families

Family	Category	Number of Sequences	3D Structure?
F032498	Metagenome / Metatranscriptome	179	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0213845_10688361	F032498	N/A	GKKWGFLPSQLGLHPRSYPAFCRERSMWKRHFTALPVPPKEESTLLLGVRRPLDPDEQLAMVVHTFDNGREGGRKRDVFNPSVGEIRKTYAYRRTPLRYRLSYLGKLAFLKLKKRKEQELRFVPAHYLSKRECDSIRLLAPWRECLASAV