NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0063869_1052333

Scaffold Ga0063869_1052333


Overview

Basic Information
Taxon OID3300021922 Open in IMG/M
Scaffold IDGa0063869_1052333 Open in IMG/M
Source Dataset NameMetatranscriptome of marine eukaryotic phytoplankton communities from Norwegian Sea - 10m ARK-5M ARK-5-2 (Eukaryote Community Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)746
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean

Source Dataset Sampling Location
Location NameArctic Ocean: Norwegian Sea
CoordinatesLat. (o)73.0188Long. (o)9.8566Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F071933Metatranscriptome121N

Sequences

Protein IDFamilyRBSSequence
Ga0063869_10523331F071933N/ALKPALSVSLVPTATASKKLCKVRMAVLKLLTASVLAFLGAAEDLNAALNSNDECNADGCAVNALQHRAMQTDDEDVENFKSEAVDFLELSTDAEYDGVEAIEFLQQLVANNSEVELLEASLEACSGGGTLPHSGCYGGNFLTEIFFVKVNGHGSSGKVSMWAKGPKSGKCIGRSYSQHGQSVSIQGVESCGLTGLQYTVNYCSNQDQVHVNIVKPLAANVVLNRKSCR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.