Scaffold Ga0063133_1028136

Overview

Basic Information

• Taxon OID: 3300021912
• Scaffold ID: Ga0063133_1028136
• Source Dataset Name: Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S7 C1 B21 (Eukaryote Community Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 661
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Prymnesium → Prymnesium polylepis (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean

Source Dataset Sampling Location

• Location Name: Atlantic Ocean
• Coordinates
  • Lat. (^o): 36.529698
  • Long. (^o): -13.939981

Associated Families

Family	Category	Number of Sequences	3D Structure?
F017834	Metatranscriptome	238	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0063133_10281361	F017834	N/A	DTNTRSRSIMGKGKGVASFDLASALTKKETRTMRKNECMIQYHLARMPMYGAHESPQYAKANELRDNIKAIEAKARERWERGHL