| Basic Information | |
|---|---|
| Taxon OID | 3300021907 Open in IMG/M |
| Scaffold ID | Ga0214480_101183 Open in IMG/M |
| Source Dataset Name | Marine eukaryotic communities from Monterey Bay, California, United States - M1_20Mar14CPVII9sort6BwellE17 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 11738 |
| Total Scaffold Genes | 13 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (23.08%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Seawater → Marine Eukaryotic Communities From Various Locations To Study Complex Ecological Interactions |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: California | |||||||
| Coordinates | Lat. (o) | 36.746 | Long. (o) | -122.0257 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F057890 | Metagenome / Metatranscriptome | 135 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0214480_1011832 | F057890 | N/A | MVLSSEGLHLLSNVAVWRHDFETINDKNVAMWHRYYTDVINFYIMKETHREWIENKNKEKMMKKEYSTSDGWEVFRFQVSEEHRINRTFDNLNDFLDYWFHEYHNRQESRNRIEPCYMKNHTKEQPGQGPTGVQQEALERYQNLSYTDKAIYRAIGKEYFRKKVDYSHMSNVNN |
| ⦗Top⦘ |