| Basic Information | |
|---|---|
| Taxon OID | 3300021896 Open in IMG/M |
| Scaffold ID | Ga0063136_1000024 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S13 C1 B13 (Eukaryote Community Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1345 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Atlantic Ocean | |||||||
| Coordinates | Lat. (o) | 42.340079 | Long. (o) | -12.879929 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F011557 | Metatranscriptome | 289 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0063136_10000241 | F011557 | N/A | LASAMVQANGCSGGSECPSDAEPKNLLSLLQTKLRMNVLEDGPSMMKNPSAMLTELEGMVRSGETPAFDLITTIKTLILDEIMPSLKTTRDTAADATQEALEAIQSCNNKSQTEEADIANTRQKSVENARSLHADCREAQKVLYNHNLTDSESYCVRLGKFLHGAEPLEIVAGSSREASVQYVKWASSTNMCSHTKVTELDNGCTASEAELEDKKIECNVAQTTFEGQFCAWKAELEANCKDLDTCHSAAVMAYDNHVSKTRTLVDKWNIETAALQKILCYCNVWLSEKDGGDNRSKHNATQFDVCKGQTHVPSSVDYGTPEDKVACLLTSVAVHPGTSGWVTQEYDNFTDFVDEVDSCPEATTVAP |
| ⦗Top⦘ |