| Basic Information | |
|---|---|
| Taxon OID | 3300021861 Open in IMG/M |
| Scaffold ID | Ga0213853_11382230 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 589 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds → Freshwater And Sediment Microbial Communities From Various Areas In North America, Analyzing Microbe Dynamics In Response To Fracking |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Pennsylvania | |||||||
| Coordinates | Lat. (o) | 41.1752 | Long. (o) | -78.4168 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F012634 | Metagenome / Metatranscriptome | 279 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0213853_113822302 | F012634 | N/A | ESLHGLQQDKGVLWLVQRYRLQPALMLFWGALLALLWSMSGDLLRRPARDQIAQIMRHGESAGVAGRRLLQRSIGAESVVSECWDQFRRRSPQDAQAISADPRFGQRLRAALQLLPLAGYRELSQLIAERRASAKGLAHVARNSADSSTNSEKKIPEEERFA |
| ⦗Top⦘ |