Scaffold Ga0213854_1399239

Overview

Basic Information

• Taxon OID: 3300021855
• Scaffold ID: Ga0213854_1399239
• Source Dataset Name: Metatranscriptome of freshwater sediment microbial communities from pre-fracked creek in Pennsylvania, United States - G-2016_18 (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 538
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds → Freshwater And Sediment Microbial Communities From Various Areas In North America, Analyzing Microbe Dynamics In Response To Fracking

Source Dataset Sampling Location

• Location Name: USA: Pennsylvania
• Coordinates
  • Lat. (^o): 41.4517
  • Long. (^o): -76.3954

Associated Families

Family	Category	Number of Sequences	3D Structure?
F009171	Metagenome / Metatranscriptome	322	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0213854_13992391	F009171	AGGAG	MSRRLLPVVLAIMALTTMGVSAWAKNDSGDTITTNLKLTAPTTIGTAQLPAGDYKVVADGSKAKFMQGNKVAAEVPCTLKDFNGKINETTFVIDHNKLTEIQVSGKTKAIEFSSGM