Basic Information | |
---|---|
Taxon OID | 3300021792 Open in IMG/M |
Scaffold ID | Ga0226836_10750109 Open in IMG/M |
Source Dataset Name | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Illium_FS922 150_kmer |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Marine Biological Laboratory |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 554 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR0-KM22-C158 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids → Characterization Of Microbial Community From Mariana Back Arc |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Illium vent field, Mariana back arc basin | |||||||
Coordinates | Lat. (o) | 18.21359 | Long. (o) | 144.70748 | Alt. (m) | Depth (m) | 3582.53 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F041138 | Metagenome | 160 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0226836_107501093 | F041138 | N/A | KEETEQFQEYARTNLPGRSDWSAFHPVCREVWWKLACEHDGFDPQSSFVVFSDDNPYIAEETP |
⦗Top⦘ |